PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G404400.1
Common NamePOPTR_0001s41490g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family NAC
Protein Properties Length: 361aa    MW: 39255.2 Da    PI: 9.484
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G404400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.18.2e-54281551128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdeelvv+yLkkk+++ +l++  +i+evd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk+
  Potri.001G404400.1  28 LPPGFRFHPTDEELVVHYLKKKTTSAPLPV-AIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKP 117
                         79****************************.88***************988899************************************* PP

                 NAM  92 vlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         vls+ ++++vg+kk Lvfy g+ pkg kt+W+mheyrl
  Potri.001G404400.1 118 VLSSgGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRL 155
                         ***977788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.62E-6524189IPR003441NAC domain
PROSITE profilePS5100561.99728189IPR003441NAC domain
PfamPF023654.2E-2829155IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009753Biological Processresponse to jasmonic acid
GO:0045995Biological Processregulation of embryonic development
GO:0048317Biological Processseed morphogenesis
GO:0080060Biological Processintegument development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MERTDSSTGG AGGGGGGGGG RGSQQPNLPP GFRFHPTDEE LVVHYLKKKT TSAPLPVAII  60
AEVDLYKFDP WELPAKATFG EQEWYFFSPR DRKYPNGARP NRAATSGYWK ATGTDKPVLS  120
SGGTQKVGVK KALVFYGGKP PKGIKTNWIM HEYRLADNKV NNKPPGCDLG NKKNSLRLDD  180
WVLCRIYKKN NTQRPMDHDK DDSMDDVLGS IPPSISVGSH QNGTLHLAKG TNFGALLDND  240
HNLFEGIISS SDGIRSSSSS LSHMASSVTK RDLLMLPPKR TLPSLYWTGE DMVGPSSSKR  300
FQGGINGDEI VVRTDGNSSV ATLLGELPQT PQLHQQTMLG SMADGIFRSP YQIPSMNWYS  360
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-732719114170Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00361DAPTransfer from AT3G15510Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU8234470.0EU823447.1 Populus tremula isolate swl284-042 NAC domain protein gene, partial cds.
GenBankEU8234610.0EU823461.1 Populus tremula isolate swl284-63E NAC domain protein gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006370307.10.0no apical meristem family protein
SwissprotQ9LD441e-126NAC56_ARATH; NAC transcription factor 56
TrEMBLB9N1L10.0B9N1L1_POPTR; No apical meristem family protein
STRINGPOPTR_0001s41490.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16233498
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.11e-119NAC domain containing protein 2